ELISA Recombinant Mouse Glucagon-like peptide 1 receptor(Glp1r),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Neuroscience Uniprot ID: O35659 Gene Names: Glp1r Organism: Mus muscµLus (Mouse) AA Sequence: GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY Expression Region: 22-145aa Sequence Info: ExtracellµLar Domain Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 30.4 kDa Alternative Name(s): Short name: GLP-1 receptor Short name: GLP-1-R Short name: GLP-1R Relevance: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Reference: "Mouse pancreatic beta-cells exhibit preserved glucose competence after disruption of the glucagon-like peptide-1 receptor gene."Flamez D., van Breusegem A., Scrocchi L.A., Quartier E., Pipeleers D., Drucker D.J., Schuit F.Diabetes 47:646-652(1998) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.