ELISA Recombinant Mouse Glucagon-like peptide 1 receptor(Glp1r),partial
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Neuroscience
Uniprot ID: O35659
Gene Names: Glp1r
Organism: Mus muscµLus (Mouse)
AA Sequence: GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY
Expression Region: 22-145aa
Sequence Info: ExtracellµLar Domain
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 30.4 kDa
Alternative Name(s): Short name: GLP-1 receptor Short name: GLP-1-R Short name: GLP-1R
Relevance: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Reference: "Mouse pancreatic beta-cells exhibit preserved glucose competence after disruption of the glucagon-like peptide-1 receptor gene."Flamez D., van Breusegem A., Scrocchi L.A., Quartier E., Pipeleers D., Drucker D.J., Schuit F.Diabetes 47:646-652(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Référence interne:
CSB-EP009514MO1-GB
URL de site web:
/shop/csb-ep009514mo1-gb-elisa-recombinant-mouse-glucagon-like-peptide-1-receptor-glp1r-partial-144658
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.