ELISA Recombinant Mouse Type-1 angiotensin II receptor-associated protein(Agtrap)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Mus muscµLus (Mouse) Uniprot NO.:Q9WVK0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MELPAVNLKVILLVHWLLTTWGCLVFSSSYAWGNFTILALGVWAVAQRDSIDAIGMFLGG LVATIFLDIIYISIFYSSVATGDTGRFGAGMAILSLLLKPFSCCLVYHMHRERGGELPLR PDFFGPSQEHSAYQTIDSSSDAAADPFASLENKGQAAPRGY Protein Names:Recommended name: Type-1 angiotensin II receptor-associated protein Alternative name(s): AT1 receptor-associated protein Gene Names:Name:Agtrap Synonyms:Atrap Expression Region:1-161 Sequence Info:fµLl length protein