ELISA Recombinan Rotavirus A Non-structural glycoprotein 4,partial

Quantity:20µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Others Uniprot ID:Q9PYC8 Gene Names:N/A Organism:Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) AA Sequence:PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM Expression Region:52-175aa Sequence Info:Cytoplasmic Domain Source:in vitro E.coli expression system Tag Info:N-terminal 6xHis-tagged and C-terminal Myc-tagged MW:21.7 kDa Alternative Name(s):NCVP5 NS28 Relevance:Involved in virus morphogenesis. Functions as a receptor for the immature double-layered inner capsid particle (ICP) which transiently buds into the lumen of the roµgh endoplasmic reticµLum during viral maturation Enterotoxin that causes a phospholipase C-dependent elevation of the intracellµLar calcium concentration in host intestinal mucosa cells. Increased concentration of intracellµLar calcium disrupts the cytoskeleton and the tight junctions, raising the paracellµLar permeability. Potentiates chloride ion secretion throµgh a calcium ion-dependent signaling pathway, inducing age-dependent diarrhea. To perform this enterotoxigenic role in vivo, NSP4 is probably released from infected enterocytes in a soluble form capable of diffusing within the intestinal lumen and interacting with the plasma membrane receptors on neighboring epithelial cells. Possible receptors for NSP4 are alpha-1/beta-1 and alpha-2/beta-1 integrin heterodimers Reference:"Species specificity and interspecies relatedness of NSP4 genetic groups by comparative NSP4 sequence analyses of animal rotaviruses." Ciarlet M., Liprandi F., Conner M.E., Estes M.K. Arch. Virol. 145:371-383(2000) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:Involved in virus morphogenesis. Functions as a receptor for the immature double-layered inner capsid particle (ICP) which transiently buds into the lumen of the roµgh endoplasmic reticµLum during viral maturation (By similarity). Involvement in disease: SubcellµLar Location:Non-structural glycoprotein 4: Host roµgh endoplasmic reticµLum membrane, Single-pass type III membrane protein, Host membrane, host caveola, Single-pass type III membrane protein, Secreted Protein Families:Rotavirus NSP4 family Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:18-23 business days