ELISA Recombinant Arabidopsis thaliana RING-H2 finger protein ATL34(ATL34)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q9C7I1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:QHQPRTTAPPYIAQRPNQVPAVIIAmLMFTLLFSmLACCVCYKYTNTSPHGTSSDTEEGG HGEVAFTRRTSRGLGKDVINSFPSFLYSQVKGLKIGKGGVECAICLNEFEDEETLRLMPP CSHAFHASCIDVWLSSRSTCPVCRASLPPKPGSDQNSLYPFIRPHDNQDMDLENVTARRS VLESPDVRLLDRLSWSNNTGANTPPRSRSTGLSNWRITELLFPRSHSTGHSLVPRVENLD RFTLQLPEEVRRQLSHMKTLPQARSSREGYRSGSVGSERRGKGKEKEFGEGSFDRLKAEM V Protein Names:Recommended name: RING-H2 finger protein ATL34 Gene Names:Name:ATL34 Ordered Locus Names:At1g35330 ORF Names:T9I1.10 Expression Region:27-327 Sequence Info:fµLl length protein