ELISA Recombinant Crotalus viridis viridis Cytochrome b(MT-CYB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Crotalus viridis viridis (Prairie rattlesnake) Uniprot NO.:Q95776 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTHQHLLTMFNLLPVGXNISTWWNFGSmLLSCLTIQIITGFFLAIHYTANINMAFSSIMH ISRDVPYGWIMQNTHAIGXSLFFICIYIHIARGIYYGSYLNKEVWLSGTTLLITLMATAS XXMCYHDT Protein Names:Recommended name: Cytochrome b Alternative name(s): Complex III subunit 3 Complex III subunit III Cytochrome b-c1 complex subunit 3 Ubiquinol-cytochrome-c reductase complex cytochrome b subunit Gene Names:Name:MT-CYB Synonyms:COB, CYTB, MTCYB Expression Region:1-128 Sequence Info:fµLl length protein