Se rendre au contenu

ELISA Recombinant KiSS-1 receptor(KISS1R)

https://assay.labm.com/web/image/product.template/134571/image_1920?unique=706639d
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q969F8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALmLLGLVGN SLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNY IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLAL HRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAmLRHLGRVAVRPAP ADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYA AYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPH AELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL Protein Names:Recommended name: KiSS-1 receptor Short name= KiSS-1R Alternative name(s): G-protein coupled receptor 54 G-protein coupled receptor OT7T175 Short name= hOT7T175 Hypogonadotropin-1 Kisspeptins receptor Metastin recepto Gene Names:Name:KISS1R Synonyms:AXOR12, GPR54 Expression Region:1-398 Sequence Info:fµLl length protein

1.755,00 € 1755.0 EUR 1.755,00 € Hors taxes

1.755,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF850246HU
URL de site web: /shop/csb-cf850246hu-elisa-recombinant-kiss-1-receptor-kiss1r-134571

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.