ELISA Recombinant Pyrophosphate-energized proton pump(hppA)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Anaplasma marginale
Uniprot NO.:Q8VRZ1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:NGSIMGALYKGLIATGLLSIVGLGVANTLTVGWGEIGTVAGKSITGTNLFVCGLIGLIVT GLIVVITEYYTGTNKRPVNSXAQASVTGHGTNVIQGLAVSLESTALPAIVIVGGIIXTYQ LAGLFGTAIAVTAmLGIAGMI
Protein Names:Recommended name: Pyrophosphate-energized proton pump EC= 3.6.1.1 Alternative name(s): Membrane-bound proton-translocating pyrophosphatase Pyrophosphate-energized inorganic pyrophosphatase Short name= H(+)-PPase
Gene Names:Name:hppA
Expression Region:1-141
Sequence Info:fµLl length protein
Référence interne:
CSB-CF840889AIAY
URL de site web:
/shop/csb-cf840889aiay-elisa-recombinant-pyrophosphate-energized-proton-pump-hppa-114235
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.