ELISA Recombinant Pyrophosphate-energized proton pump(hppA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Anaplasma marginale Uniprot NO.:Q8VRZ1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:NGSIMGALYKGLIATGLLSIVGLGVANTLTVGWGEIGTVAGKSITGTNLFVCGLIGLIVT GLIVVITEYYTGTNKRPVNSXAQASVTGHGTNVIQGLAVSLESTALPAIVIVGGIIXTYQ LAGLFGTAIAVTAmLGIAGMI Protein Names:Recommended name: Pyrophosphate-energized proton pump EC= 3.6.1.1 Alternative name(s): Membrane-bound proton-translocating pyrophosphatase Pyrophosphate-energized inorganic pyrophosphatase Short name= H(+)-PPase Gene Names:Name:hppA Expression Region:1-141 Sequence Info:fµLl length protein