ELISA Recombinant Putative vomeronasal receptor-like protein 4(VN1R17P)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q8TDU5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEMTKLFSYIVIKNVYYPQVSFGISANTFLLLFHIFTFAYTHRLKPIDMTISHLPLIHIL LLFTQAILVSSDLFESWNIQNNDLKCKIITFLNRVMRGVSICTTCLLSVLQAITISPSTS FLEKFKHISANHTLGFILFSWVLNMFITNNLLLFIVPTPNRIGASLLFVTEHCYVLPMSY THRSLFFILMVLRDVIFIGLMVLSSGYG Protein Names:Recommended name: Putative vomeronasal receptor-like protein 4 Alternative name(s): G-protein coupled receptor GPCR23 Short name= hGPCR23 Gene Names:Name:VN1R17P Synonyms:VNRL4 Expression Region:1-208 Sequence Info:fµLl length protein