Se rendre au contenu

ELISA Recombinant Staphylococcus epidermidis Sensor protein vraS(vraS)

https://assay.labm.com/web/image/product.template/158763/image_1920?unique=b3f4f0f
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus epidermidis (strain ATCC 12228) Uniprot NO.:Q8CRV2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNHYIRAIGSmLILVYSmLIAFLFIDKVFVNIIFFQGMFYTQIFGIPVFLFLNLLIVLLC IIVGSVLAYKINQQNDWIISQIERSIEGQTVGINDQNIELYTETIDIYHTLVPLNQELHR LRMKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVSQQLFAASMmLSAIKESKLEP PLNQQIPILEKMVQDSQLEMRALLLHLRPIGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI QDFEVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNQEDYLLLRIQDNGKGFNVDEK FEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNKEENSSGD Protein Names:Recommended name: Sensor protein vraS EC= 2.7.13.3 Gene Names:Name:vraS Ordered Locus Names:SE_1570 Expression Region:1-348 Sequence Info:fµLl length protein

1.702,00 € 1702.0 EUR 1.702,00 € Hors taxes

1.702,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF813282SLD
URL de site web: /shop/csb-cf813282sld-elisa-recombinant-staphylococcus-epidermidis-sensor-protein-vras-vras-158763

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.