Se rendre au contenu

ELISA Recombinant Bradyrhizobium japonicum Prolipoprotein diacylglyceryl transferase(lgt)

https://assay.labm.com/web/image/product.template/120327/image_1920?unique=7485b17
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bradyrhizobium japonicum (strain USDA 110) Uniprot NO.:Q89DJ5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMPFLLIDFPAFKPIAIEIGPFAIRWYALAYICGIVFGWLYARSLLKNERLWGGPAPISL VQVDDFILWVTLGIILGGRTGYVLFYNLPFFIEHPAAIFRLWEGGMSFHGGFLGCVVAVM WFAYRNGIPILSLGDITTAVAPVGLLLGRIANFINGELWGRATDASLPWAMVFPNDPTQL PRHPSQLYEAGMEGILLFTVLAIMIRLGALKRPGMILGAFILIYGLTRIAGEHFREPDVQ LGFLWGGLTMGmLLSIPmLIVGLILIVLAIRRGAPRPIEAIR Protein Names:Recommended name: Prolipoprotein diacylglyceryl transferase EC= 2.4.99.- Gene Names:Name:lgt Ordered Locus Names:blr7444 Expression Region:1-282 Sequence Info:fµLl length protein

1.633,00 € 1633.0 EUR 1.633,00 € Hors taxes

1.633,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.

Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF804181BVW
URL de site web: /shop/csb-cf804181bvw-elisa-recombinant-bradyrhizobium-japonicum-prolipoprotein-diacylglyceryl-transferase-lgt-120327

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.