Se rendre au contenu

ELISA Recombinant Adiantum capillus-veneris Photosystem II CP47 chlorophyll apoprotein(psbB)

https://assay.labm.com/web/image/product.template/115593/image_1920?unique=bf930ac
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Adiantum capillus-veneris (Maidenhair fern) Uniprot NO.:Q85FJ7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGLPWYRVHTVVLNDPGRLISVHLMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRIGVSKSWGGWIITGDTSTDAGIWSYEGVAAAHIILSGLLFLAAIWHWVYWDL DLFRDDRTGKPSLDLPKIFGIHLFLSGVLCFSFGAFHVTGLFGPGIWISDPYGLTGKVEP VDPAWGAEGFDPFIPGGIASHHIAAGVLGILAGLFHLSVRPPQRLYKALRMGNVETVLSS SIAAVFFAAFVVSGTMWYGSAATPIELFGPTRYQWDQGYFQQEIERRIRLGEAENLSLSQ VWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHALFKDREGRELFVRRMP TFFETFPVVLVDGEGVVRADVPFRRAESKYSVEQVGVTVDFFGGELDGASFSDPATVKKY ARRAQLGEIFEFDRATLKSDGVFRSSPRGWFTFGHTTFALIFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPSTKKQAV Protein Names:Recommended name: Photosystem II CP47 chlorophyll apoprotein Alternative name(s): PSII 47 kDa protein Protein CP-47 Gene Names:Name:psbB Expression Region:1-508 Sequence Info:fµLl length protein

1.871,00 € 1871.0 EUR 1.871,00 € Hors taxes

1.871,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF774657AXO
URL de site web: /shop/csb-cf774657axo-elisa-recombinant-adiantum-capillus-veneris-photosystem-ii-cp47-chlorophyll-apoprotein-psbb-115593

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.