ELISA Recombinant Probable oxaloacetate decarboxylase gamma chain(oadG)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vibrio parahaemolyticus
Uniprot NO.:Q87LR6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTNIGSLLVDAATLMVTGMAVVFIFLTILVYLVRLLSKLVPEEVPEPIAAPKTNTRVQST SSAVSPQVVAAISAAIHQHRASIAK
Protein Names:Recommended name: Probable oxaloacetate decarboxylase gamma chain EC= 4.1.1.3
Gene Names:Name:oadG Ordered Locus Names:VP2545
Expression Region:1-85
Sequence Info:fµLl length protein
Référence interne:
CSB-CF771605VFE
URL de site web:
/shop/csb-cf771605vfe-elisa-recombinant-probable-oxaloacetate-decarboxylase-gamma-chain-oadg-113872
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.