ELISA Recombinant Probable oxaloacetate decarboxylase gamma chain(oadG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vibrio parahaemolyticus Uniprot NO.:Q87LR6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTNIGSLLVDAATLMVTGMAVVFIFLTILVYLVRLLSKLVPEEVPEPIAAPKTNTRVQST SSAVSPQVVAAISAAIHQHRASIAK Protein Names:Recommended name: Probable oxaloacetate decarboxylase gamma chain EC= 4.1.1.3 Gene Names:Name:oadG Ordered Locus Names:VP2545 Expression Region:1-85 Sequence Info:fµLl length protein