ELISA Recombinant Glycerol-3-phosphate acyltransferase 3(plsY3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bacillus anthracis Uniprot NO.:Q81Y92 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVTTYLLFIVAYLLGSIPFALVVGKIGYGIDIREHGSGNLGGTNTFRTLGKKAGFTVTIA DILKGTLATSLPMVFGLDIHPLWFGLAAVLGHVYPIFAKFRGGKAVATSAGVLLCYSPVV FAILAVVFFTLLFTTRYVSLSSMVTAVVAVIASIVTGDKIFIIAMCLLAGMVIYKHRANI GRIINKTEPKANFSKKQK Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase 3 Alternative name(s): Acyl-PO4 G3P acyltransferase 3 Acyl-phosphate--glycerol-3-phosphate acyltransferase 3 G3P acyltransferase 3 Short name= GPAT 3 EC= 2.3.1.n3 Lys Gene Names:Name:plsY3 Ordered Locus Names:BA_3665, GBAA_3665, BAS3399 Expression Region:1-198 Sequence Info:fµLl length protein