Se rendre au contenu

ELISA Recombinant Macaca silenus Melanocyte-stimulating hormone receptor(MC1R)

https://assay.labm.com/web/image/product.template/142611/image_1920?unique=62ab6da
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Macaca silenus (Lion-tailed macaque) Uniprot NO.:Q864J7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPVQGSQRRLLGSLNSTPTATPHLGLAANQTGARCLEMSIPDGLFLSLGLVSLVENVLVV TAIAKNRNLHSPMYCFICCLALSDLLVSGSNmLETAVTLLLEAGALAARAAVVQQLDNVI DVITCSSmLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAIAAIWVASVLCSTLFI AYYDHAAVLLCLVVFFLAmLVLMAVLYVHmLARACQHAQGIARLHKRQRLAHQGFGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAF RSQELRRTLKEVLLCSW Protein Names:Recommended name: Melanocyte-stimµLating hormone receptor Short name= MSH-R Alternative name(s): Melanocortin receptor 1 Short name= MC1-R Gene Names:Name:MC1R Expression Region:1-317 Sequence Info:fµLl length protein

1.670,00 € 1670.0 EUR 1.670,00 € Hors taxes

1.670,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF769679MNC
URL de site web: /shop/csb-cf769679mnc-elisa-recombinant-macaca-silenus-melanocyte-stimulating-hormone-receptor-mc1r-142611

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.