ELISA Recombinant Danio rerio Protein reprimo B(rprmb)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Danio rerio (Zebrafish) (Brachydanio rerio) Uniprot NO.:Q6PBK8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNSTGFNDTDSALFSNTSFLSCCNVSSVVTDSGFVSAALDERSVFIMRTVQIAVMCVLAL TVVFGIFFLGCNLLIKSEGMINFLVTDRRPSKDVEAVIVGSY Protein Names:Recommended name: Protein reprimo B Gene Names:Name:rprmb Synonyms:rprm ORF Names:zgc:73361 Expression Region:1-102 Sequence Info:fµLl length protein