ELISA Recombinant Gloeobacter violaceus Cytochrome b6-f complex iron-sulfur subunit(petC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Gloeobacter violaceus (strain PCC 7421) Uniprot NO.:Q7NCE1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSESAAQEIPMSRRQLLSFVTGGAIAATTAATLYPVVLYFLPPSTAGGGEGVAAKDKEGK DISVSKLLAAATPGEPVLTLGLDVNGGDATYIVINDQKEIANFGINAVCTHLGCVVPWDN GAKQFKCPCHGSVYNADGGLERGPAPQPLALVKATVSDDKVLIAPWTEQDFRCTDLWCNK DPYWVK Protein Names:Recommended name: Cytochrome b6-f complex iron-sµLfur subunit EC= 1.10.9.1 Alternative name(s): Plastohydroquinone:plastocyanin oxidoreductase iron-sµLfur protein Short name= ISP Short name= RISP Rieske iron-sµLfur protein Gene Names:Name:petC Ordered Locus Names:glr3038 Expression Region:1-186 Sequence Info:fµLl length protein