Se rendre au contenu

ELISA Recombinant Treponema denticola Membrane protein insertase YidC(yidC)

https://assay.labm.com/web/image/product.template/160094/image_1920?unique=b3f4f0f
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) Uniprot NO.:Q73JM1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKKNTVLAVVLSmLVFGGWLYIQQKYFPTEYNVPQKPVAQAQGQNPTSSEIAVQTSSNQI SNSMIEAVADSDYPSREQTYVIETDIIRAVFTNKGGDIISYKLKEHASAGSDERVEMIEN VTERNRALSLALGGHDAQAVDLLFNVKEESLSDGRKQIGFYRDIKLKNTDGSETVFTLAK RYTFIPGDYMFTLEVTIDGKEGMRGLSFGDSAYTLRSAPQIGPEWDKVNDKYEYRALSYF ANEKKKEDRSITDGKTKAVNDLASWVSVSGKYFSFIIIPKDPIQKMFFSGIKEEGAKLHN SQFFISRQPIVGNAAYDQYRVYIGPSSEKILNSYNSAAANNYGYENLRIDSLAASSGFLA PLERVLKFVMEIFYKIIPNWGVALLLLTLLMRIIFFPLTKKSSEATKRMQELQPQINELQ QKYKNNPQKLNAEMVKFYKEAGYNPASGCLPLLIQLPFLFAMFGLFNNYFEFRGASFIPG WIPDLSVGDSILKFGFTIPFLNWTDLRLLPIIYTASQLLHGKLTQTPGQSQQNPSMKIMI YFMPLFFFFLFYNAPSGLLLFWTFSNILmLLQQLIINKSMKK Protein Names:Recommended name: Membrane protein insertase YidC Alternative name(s): Foldase YidC Membrane integrase YidC Membrane protein YidC Gene Names:Name:yidC Ordered Locus Names:TDE_2396 Expression Region:1-582 Sequence Info:fµLl length protein

1.949,00 € 1949.0 EUR 1.949,00 € Hors taxes

1.949,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.

Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF744777TPP
URL de site web: /shop/csb-cf744777tpp-elisa-recombinant-treponema-denticola-membrane-protein-insertase-yidc-yidc-160094

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.