ELISA Recombinant Erwinia carotovora subsp. atroseptica NADH-quinone oxidoreductase subunit A(nuoA)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Erwinia carotovora subsp. atroseptica (Pectobacterium atrosepticum)
Uniprot NO.:Q6D2R7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTTTEILAHHWAFALFLIIAIGLCVFmLTGGFLLGGRAKGRAKNVPYESGIDSVGSARL RLSAKFYLVAMFFVIFDVEALYLYAWAVSIKESGWIGFIEATIFILVLLAGLIYLVRVGA LDWTPVRSKRQVVKSDIINTTNTHPQ
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1
Gene Names:Name:nuoA Ordered Locus Names:ECA3028
Expression Region:1-146
Sequence Info:fµLl length protein
Référence interne:
CSB-CF732134EAAB
URL de site web:
/shop/csb-cf732134eaab-elisa-recombinant-erwinia-carotovora-subsp-atroseptica-nadh-quinone-oxidoreductase-subunit-a-nuoa-125559
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.