Se rendre au contenu

ELISA Recombinant Xenopus laevis E3 ubiquitin-protein ligase MARCH2(41335)

https://assay.labm.com/web/image/product.template/161163/image_1920?unique=871b00d
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q5PQ35 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTTGDCCHLPGSLCDCTDSATFLKSLEESDLGRPQYVTQVTAKDGQLLSTVIKALGTQSD GPICRICHEGGNGERLLSPCDCTGTLGTVHKTCLEKWLSSSNTSYCELCHTEFAVERRPR PVTEWLKDPGPRHEKRTLFCDMVCFLFITPLAAISGWLCLRGAQDHLQFNSRLEAVGLIA LTIALFTIYVLWTLVSFRYHCQLYSEWRRTNQKVLLLIPDSKTATTIHHSFLSSKLLKFA SDETTV Protein Names:Recommended name: E3 ubiquitin-protein ligase MARCH2 EC= 6.3.2.- Alternative name(s): Membrane-associated RING finger protein 2 Membrane-associated RING-CH protein II Short name= MARCH-II Gene Names:Name:march2 Expression Region:1-246 Sequence Info:fµLl length protein

1.595,00 € 1595.0 EUR 1.595,00 € Hors taxes

1.595,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF719012XBE
URL de site web: /shop/csb-cf719012xbe-elisa-recombinant-xenopus-laevis-e3-ubiquitin-protein-ligase-march2-41335-161163

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.