ELISA Recombinant Thermus thermophilus Uncharacterized PIN and TRAM-domain containing protein TTHA0540(TTHA0540)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Uniprot NO.:Q5SKV3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:DWGLLPQSPSLLSLNRLYLALAGLLTGLLLGPRLEGALEARLKRLRSLPPEVVVATTLGS TIGLLLAVLLTTLLAQVPGFSPVHSLLLALGLVALFVYLALGYRAYFRLPEPKPAPRGGK VLDTSVLVDGRVAEVAAVGFLEGPLWVPHFVLKELQHFADSQDPLRRAKGRRGLETLERL REAAPLEVLETTPKGESVDEKLLFLARDLEAALVTNDHALLQMARIYGVKALSIQALAQA LRPQLQVGDTLKLLILKEGKEPHQGVGYLEDGSMVVVDGGSRYRGQEIEVVVTQAIQTQV GRLFFARPAQGAQ Protein Names:Recommended name: Uncharacterized PIN and TRAM-domain containing protein TTHA0540 Gene Names:Ordered Locus Names:TTHA0540 Expression Region:24-336 Sequence Info:fµLl length protein