Se rendre au contenu

ELISA Recombinant Mouse Uncharacterized protein C17orf78 homolog(Gm11437)

https://assay.labm.com/web/image/product.template/146690/image_1920?unique=c91b609
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Mus muscµLus (Mouse) Uniprot NO.:Q5QR91 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDTILVFSLMIASYDSNKNDLRKSSCQVEQWPSFFSEDVRSNKDLVVRVPLEIHTDTKGT PFIQNQPIATLRCLGSGRRVTVHLVYSERRPKVKYIMKNLPVITDLPRNSTASPRCHLRA TSQFQNGSLLTAFLPGISQCTVYSAKDRSASSEMVPITTSSTTPRSKGDEATSTGAFPNP LTQGIDMSLKRRQKWSLVVKALIAVTLLLGGAAIIVFVIFEVPCPSQCLRVRQLCQCQWL WRRKRKEEDQKPGTTESQLDSQPEKVKHNVPNSSDSKKTTDIAIIYQTYF Protein Names:Recommended name: Uncharacterized protein C17orf78 homolog Gene Names:Name:Gm11437 Expression Region:1-290 Sequence Info:fµLl length protein

1.641,00 € 1641.0 EUR 1.641,00 € Hors taxes

1.641,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF712746MO
URL de site web: /shop/csb-cf712746mo-elisa-recombinant-mouse-uncharacterized-protein-c17orf78-homolog-gm11437-146690

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.