Se rendre au contenu

ELISA Recombinant Synechocystis sp. Iron stress-induced chlorophyll-binding protein(isiA)

https://assay.labm.com/web/image/product.template/159597/image_1920?unique=b3f4f0f
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Synechocystis sp. (strain PCC 6803 / Kazusa) Uniprot NO.:Q55274 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQTYGNDTVQYEWWAGNARFADQSGLFIAAHVAQAALTAFWAGAFTLFEISRFDPTQAMG DQGLILLPHLATLGWGVGDGGQIVDTYPYFVIGSIHLIASAVLGAGALFHTLRAPADLST LKGQGKKFHFTWENPQQLGIILGHHLLFLGAGALLLAGKAMYWGGLYDATTQTVRLVSQP TLDPLVIYGYQTHFASISSLEDLVGGHIFVGFLLIGGGIWHILVPPLGWAKKVLLFSGEA ILSYSLGGIALAGFVAAYFCAVNTLAYPPEFYGPPLAIKLGIFPYFADTVELPMHAHTSR AWLANAHFFLAFFFLQGHLWHALRALGFDFKRVEQAFDSLQT Protein Names:Recommended name: Iron stress-induced chlorophyll-binding protein Alternative name(s): CP43' Gene Names:Name:isiA Ordered Locus Names:sll0247 Expression Region:1-342 Sequence Info:fµLl length protein

1.696,00 € 1696.0 EUR 1.696,00 € Hors taxes

1.696,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF709909SSQ
URL de site web: /shop/csb-cf709909ssq-elisa-recombinant-synechocystis-sp-iron-stress-induced-chlorophyll-binding-protein-isia-159597

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.