ELISA Recombinant Nitric oxide reductase subunit C(norC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Paracoccus denitrificans Uniprot NO.:Q51662 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SEIMTKNMARNVFYGGSIFFILIFGALTVHSHIYARTKAVDESQLTPSVVEGKHIWERNA CIDCHTLLGEGAYFAPELGNVMKRWGVQDDPDSAFETLKGWMESMPTGIEGRRQMPRFDL TDEEFRALSDFLLWTGTINTQNWPPNDAG Protein Names:Recommended name: Nitric oxide reductase subunit C Alternative name(s): NOR small subunit Nitric oxide reductase cytochrome c subunit Gene Names:Name:norC Expression Region:2-150 Sequence Info:fµLl length protein