Se rendre au contenu

ELISA Recombinant Dictyostelium discoideum P2X receptor D(p2xD)

https://assay.labm.com/web/image/product.template/124209/image_1920?unique=9fe42c5
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Dictyostelium discoideum (Slime mold) Uniprot NO.:Q54J33 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDWDNIFSYNTAKIVTIKDRRLGGLHIIFMVLIIVYIVIYSTIYKKGYLLTETPVGSIRA SLLAPNEFKDDSNFKYCDDNLIEYNFTKLECDYYDEAFVSFPVGDDVSFAVTTRVKTLDQ VLNCSSKNPKCKYTTVSTRNVYVSDIEDFTILIDHTMFAPSSLIQYNSKQLKGYILDNDN NEIQINETINTVGIPGKPDILTIGKLLQLANIDLDGASSVNSTNSVRYDGVVALVFITYS NTFSYNTNNFKYVYSIQKVEDTEYGVPEAVILDNVSSRMYYNRHGIRLIFIQNGEIGSFN FQALLLTFVSGLGLLAISTVLVDQLAIRFLPERKTYSSHKFQITHGFSESRNKLRISQNE KDPLLLVETTKNNENNNNNDDYNDDDNEIFDDNNNGYQNIQNNNIIL Protein Names:Recommended name: P2X receptor D Short name= P2XD Gene Names:Name:p2xD ORF Names:DDB_G0288335 Expression Region:1-407 Sequence Info:fµLl length protein

1.765,00 € 1765.0 EUR 1.765,00 € Hors taxes

1.765,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF700766DKK
URL de site web: /shop/csb-cf700766dkk-elisa-recombinant-dictyostelium-discoideum-p2x-receptor-d-p2xd-124209

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.