Se rendre au contenu

ELISA Recombinant Dictyostelium discoideum SrfA-induced gene G protein(sigG)

https://assay.labm.com/web/image/product.template/124353/image_1920?unique=45d657d
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Dictyostelium discoideum (Slime mold) Uniprot NO.:Q54GL3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTPTRTKKLIVSPTSVRKRVQNQNLTNTTYSTNSNSSRYRDSEENFLNRQQQELKQLHD QQLYELQELQEQQINEIEELSKQRSNTRIRNVFKVLITILVGSIIYGTYTNQFQPNPIEP FHLTEPIGQTWLHSLKDISTNWYHIWSDSFKDLARIKPLSESQTMPAGHRLHEKQILEKT LRRHQQEQDNNNNNKKTIENQMERMKRTDLERAIKEKTFFLDPTHYVNEEMIKQEIERQL KPHPGAPTPYNKDVYNSQNIYYPSSDAIPMVREKIENLENKVLDSVDEAIYKFGQKSKEL LHNIQEKKEQIKEKLNDEPSNIEKEFNSLIKEIEKANYNIFKDLKDNYGEPTIEKLNELR YKFNDAARESREVIKNKIESAQAIEQELAKNLKKPHADSNGHPKPYPHHHLLNQENQIDE NLIIV Protein Names:Recommended name: SrfA-induced gene G protein Gene Names:Name:sigG ORF Names:DDB_G0290071 Expression Region:1-425 Sequence Info:fµLl length protein

1.784,00 € 1784.0 EUR 1.784,00 € Hors taxes

1.784,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF690561DKK
URL de site web: /shop/csb-cf690561dkk-elisa-recombinant-dictyostelium-discoideum-srfa-induced-gene-g-protein-sigg-124353

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.