Se rendre au contenu

ELISA Recombinant Macaca fascicularis N-arachidonyl glycine receptor(GPR18)

https://assay.labm.com/web/image/product.template/142410/image_1920?unique=62ab6da
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Macaca fascicµLaris (Crab-eating macaque) (Cynomolgus monkey) Uniprot NO.:Q4R613 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MITLNNQDQPVPFNNSYPDEYEIAALVFYSCIFIIGLFVNITALWVFSCTTKKRTTVTIY MMNVALVDLIFIMTLPFRMFYYAKDEWPFGEYFCQILGALTVFYPSIALWLLAFISADRY MAIVQPKYAKELKNTCKAVLACVGVWIMTLTTTIPLLLLHKDPDKDSTPATCLKISDIVY LKAVNVLNFTRLTFFFLIPLFIMIGCYLVIIHNLLHGRTSKLKPKVKEKSIRIIITLLVQ VLVCFMPFHICFAFLmLGTGENSYSPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISV mLYRNYLRGMRRKSFRSGSLRSLSNINSEmL Protein Names:Recommended name: N-arachidonyl glycine receptor Short name= NAGly receptor Alternative name(s): G-protein coupled receptor 18 Gene Names:Name:GPR18 ORF Names:QtsA-19357 Expression Region:1-331 Sequence Info:fµLl length protein

1.684,00 € 1684.0 EUR 1.684,00 € Hors taxes

1.684,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF689968MOV
URL de site web: /shop/csb-cf689968mov-elisa-recombinant-macaca-fascicularis-n-arachidonyl-glycine-receptor-gpr18-142410

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.