ELISA Recombinant Varicella-zoster virus Ribonucleoside-diphosphate reductase small chain(ORF18)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Varicella-zoster virus (strain Oka vaccine) (HHV-3) ( herpesvirus 3) Uniprot NO.:Q4JQV7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDQKDCSHFFYRPECPDINNLRALSISNRWLESDFIIEDDYQYLDCLTEDELIFYRFIFT FLSAADDLVNVNLGSLTQLFSQKDIHHYYIEQECIEVVHARVYSQIQLmLFRGDESLRVQ YVNVTINNPSIQQKVQWLEEKVRDNPSVAEKYILMILIEGIFFVSSFAAIAYLRNNGLFV VTCQFNDLISRDEAIHTSASCCIYNNYVPEKPAITRIHQLFSEAVEIECAFLKSHAPKTR LVNVDAITQYVKFSADRLLSAINVPKLFNTPPPDSDFPLAFMIADKNTNFFERHSTSYAG TVINDL Protein Names:Recommended name: Ribonucleoside-diphosphate reductase small chain Short name= R2 EC= 1.17.4.1 Alternative name(s): Ribonucleotide reductase small subunit Gene Names:ORF Names:ORF18 Expression Region:1-306 Sequence Info:fµLl length protein