ELISA Recombinant Zea mays Derlin-1.1(DER1.1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:Q4G2J6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSPAEYYKSLPPISKAYGTLCFFTTVLVQLQILHPLFLYLDYPLVFKKFEIWRLLTSFF FLAPFSMKFGIRLLMIARYGVmLEKGAFDKRTADFLWMMIFGAISLLVLSIIPLFNSFFL GIPMVSmLLYVWSRENPNAQINIYGLVQLRSFYLPWAmLLLDVIFGSSLMPGLLGIMVGH LYYFFAVLHPLATGKSYLKTPKWVHKIVARFRIGMQANSPVRPPANGNSGSGVFRGRSYR LNQ Protein Names:Recommended name: Derlin-1.1 Alternative name(s): ZmDerlin1-1 Gene Names:Name:DER1.1 Synonyms:SOR Expression Region:1-243 Sequence Info:fµLl length protein