Se rendre au contenu

ELISA Recombinant Trypanosoma brucei brucei Phosphatidylethanolamine:ceramide ethanolaminephosphotransferase(SLS2)

https://assay.labm.com/web/image/product.template/160281/image_1920?unique=871b00d
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Trypanosoma brucei brucei (strain 927/4 GUTat10.1) Uniprot NO.:Q38E54 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAVPPVEMYSGSFWNRMRKPLPLRTQVIRFTVVFVIVSFILAVALQITHERMPDPKVTKP LPDLGFEVLHKYPFLFSVADCCIGFLNILSVFTAFKLYLLHRHCVGSGEPELPCNIPGVS RFFLSVWLCKENCRIELRNVHTIAWIRFITSYALLLLSRSVIMVVTSLPNPDDLCQDPPK IENRVKDVILTVLTAGAGSIHCGDLMYSGHTVILTLHLMFHWIYGAMVHWSFRPVVTVVA IFGYYCIVASRFHYTDDVLVAIYLTIATFIAVGHNADGAPWQLQLFIRWLPCCGANSREV TEDGVPVAIVIKNEEMMNFEGKS Protein Names:Recommended name: Phosphatidylethanolamine:ceramide ethanolaminephosphotransferase EC= 2.7.8.- Alternative name(s): Ethanolamine-phosphorylceramide synthase Short name= EPC synthase Sphingolipid synthase Gene Names:Name:SLS2 ORF Names:Tb09.211.1020 Expression Region:1-323 Sequence Info:fµLl length protein

1.676,00 € 1676.0 EUR 1.676,00 € Hors taxes

1.676,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF653635TIY
URL de site web: /shop/csb-cf653635tiy-elisa-recombinant-trypanosoma-brucei-brucei-phosphatidylethanolamine-ceramide-ethanolaminephosphotransferase-sls2-160281

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.