ELISA Recombinant Bovine Vesicle transport protein GOT1A(GOLT1A)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q2NKV8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MISITEWQKIGVGTTGFGIFFILFGmLLYFDSVLLAFGNLLFLTGLSLIIGLRRTFSFFF QRHKFKGTSFFLGGVVIVLLRWPLLGMCLETYGFFSLFRGFFPVAFGFLGSASNIPFLSA LFQRLQGTSSMV Protein Names:Recommended name: Vesicle transport protein GOT1A Alternative name(s): Golgi transport 1 homolog A Gene Names:Name:GOLT1A Expression Region:1-132 Sequence Info:fµLl length protein