ELISA Recombinant Bovine Tumor protein p53-inducible protein 11(TP53I11)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q0VCQ8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFAVREPL GLRVWQFVSAVLFSGIAIMALAFPDQLYDAVFDGAQVTSKTPIRLYGGALLSISLIMWNA LYTAEKVIIRWTLLTEACYFSVQFLVVTATLAETGLASQGILLLLASRLLFVAISVYYYY QVGRKPKKV Protein Names:Recommended name: Tumor protein p53-inducible protein 11 Alternative name(s): p53-induced gene 11 protein Gene Names:Name:TP53I11 Synonyms:PIG11 Expression Region:1-189 Sequence Info:fµLl length protein