ELISA Recombinant Bovine Tumor protein p53-inducible protein 11(TP53I11)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:Q0VCQ8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFAVREPL GLRVWQFVSAVLFSGIAIMALAFPDQLYDAVFDGAQVTSKTPIRLYGGALLSISLIMWNA LYTAEKVIIRWTLLTEACYFSVQFLVVTATLAETGLASQGILLLLASRLLFVAISVYYYY QVGRKPKKV
Protein Names:Recommended name: Tumor protein p53-inducible protein 11 Alternative name(s): p53-induced gene 11 protein
Gene Names:Name:TP53I11 Synonyms:PIG11
Expression Region:1-189
Sequence Info:fµLl length protein
This content will be shared across all product pages.
Référence interne:
CSB-CF605758BO
URL de site web:
/shop/csb-cf605758bo-elisa-recombinant-bovine-tumor-protein-p53-inducible-protein-11-tp53i11-120249
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.