Se rendre au contenu

ELISA Recombinant Bovine Tumor protein p53-inducible protein 11(TP53I11)

https://assay.labm.com/web/image/product.template/120249/image_1920?unique=7485b17
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q0VCQ8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFAVREPL GLRVWQFVSAVLFSGIAIMALAFPDQLYDAVFDGAQVTSKTPIRLYGGALLSISLIMWNA LYTAEKVIIRWTLLTEACYFSVQFLVVTATLAETGLASQGILLLLASRLLFVAISVYYYY QVGRKPKKV Protein Names:Recommended name: Tumor protein p53-inducible protein 11 Alternative name(s): p53-induced gene 11 protein Gene Names:Name:TP53I11 Synonyms:PIG11 Expression Region:1-189 Sequence Info:fµLl length protein

1.534,00 € 1534.0 EUR 1.534,00 € Hors taxes

1.534,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.

Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF605758BO
URL de site web: /shop/csb-cf605758bo-elisa-recombinant-bovine-tumor-protein-p53-inducible-protein-11-tp53i11-120249

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.