ELISA Recombinant Archaeoglobus fulgidus Molybdate-tungstate transport system permease protein wtpB(wtpB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Archaeoglobus fµLgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) Uniprot NO.:O30143 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRLLFSALLALLSSIILLFVLLPVAATVTLQLFNFDEFLKAASDPAVWKVVLTTYYAALI STLIAVIFGTPLAYILARKSFPGKSVVEGIVDLPVVIPHTVAGIALLVVFGSSGLIGSFS PLKFVDALPGIVVAmLFVSVPIYINQAKEGFASVDVRLEHVARTLGSSPLRVFFTVSLPL SVRHIVAGAIMSWARGISEFGAVVVIAYYPMIAPTLIYERYLSEGLSAAMPVAAILILLS LAVFVALRIIVGREDVSEGQG Protein Names:Recommended name: Molybdate/tungstate transport system permease protein wtpB Gene Names:Name:wtpB Synonyms:modB Ordered Locus Names:AF_0093 Expression Region:1-261 Sequence Info:fµLl length protein