Se rendre au contenu

ELISA Recombinant Ricinus communis CASP-like protein RCOM_0464280 (RCOM_0464280)

https://assay.labm.com/web/image/product.template/153872/image_1920?unique=e16ca1f
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ricinus communis (Castor bean) Uniprot NO.:B9SR15 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRSPQSLRNGETPSPSPRPPRFPTPHFHSTVSLQKLKRFNLLILVFRLSTFCFSLASSVF mLTNPTWYHFDAFRYVFAANAIVAIYSLFEMAASVWEISRGNTLFPEILQVWFDFGHDQV FAYLLLSADSAATALAKTLKGGDTCAASNAFCVQSYIAIALGFAGFLFLGLSSLLSGFRV VCFLINGSRFYV Protein Names:Recommended name: CASP-like protein RCOM_0464280 Gene Names:ORF Names:RCOM_0464280 Expression Region:1-192 Sequence Info:fµLl length protein

1.538,00 € 1538.0 EUR 1.538,00 € Hors taxes

1.538,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF497505RMM
URL de site web: /shop/csb-cf497505rmm-elisa-recombinant-ricinus-communis-casp-like-protein-rcom-0464280-rcom-0464280-153872

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.