ELISA Recombinant Ricinus communis CASP-like protein RCOM_0464280 (RCOM_0464280)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ricinus communis (Castor bean) Uniprot NO.:B9SR15 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRSPQSLRNGETPSPSPRPPRFPTPHFHSTVSLQKLKRFNLLILVFRLSTFCFSLASSVF mLTNPTWYHFDAFRYVFAANAIVAIYSLFEMAASVWEISRGNTLFPEILQVWFDFGHDQV FAYLLLSADSAATALAKTLKGGDTCAASNAFCVQSYIAIALGFAGFLFLGLSSLLSGFRV VCFLINGSRFYV Protein Names:Recommended name: CASP-like protein RCOM_0464280 Gene Names:ORF Names:RCOM_0464280 Expression Region:1-192 Sequence Info:fµLl length protein