ELISA Recombinant Uncharacterized membrane protein ydzN(ydzN)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bacillus subtilis Uniprot NO.:C0H3V7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRWSKWFNVFCIVALGSIYGYKLFTNQEVSTTRLIIASVIVLWNIVGLFSKESVKQAQQA N Protein Names:Recommended name: Uncharacterized membrane protein ydzN Gene Names:Name:ydzN Ordered Locus Names:BSU05109 Expression Region:1-61 Sequence Info:fµLl length protein