ELISA Recombinant Escherichia coli O45:K1 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF(arnF)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli O45:K1 (strain S88 / ExPEC) Uniprot NO.:B7MG26 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGLMWGLFSVIIASAAQLSMGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLmLIF LPTTKQRY Protein Names:Recommended name: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Short name= L-Ara4N-phosphoundecaprenol flippase subunit ArnF Alternative name(s): Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF Gene Names:Name:arnF Ordered Locus Names:ECS88_2409 Expression Region:1-128 Sequence Info:fµLl length protein