Se rendre au contenu

ELISA Recombinant Salmonella dublin Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase(arnC)

https://assay.labm.com/web/image/product.template/155403/image_1920?unique=9b59aed
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Salmonella dublin (strain CT_02021853) Uniprot NO.:B5FNT8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFDAAPIKKVSVVIPVYNEQESLPELIRRTTAACESLGKAWEILLIDDGSSDSSAELMVK ASQEADSHIISILLNRNYGQHAAIMAGFSHVSGDLIITLDADLQNPPEEIPRLVAKADEG FDVVGTVRQNRQDSLFRKSASKIINLLIQRTTGKAMGDYGCmLRAYRRPIIDTmLRCHER STFIPILANIFARRATEIPVHHAEREFGDSKYSFMRLINLMYDLVTCLTTTPLRLLSLLG SVIAIGGFSLSVLLIVLRLALGPQWAAEGVFmLFAVLFTFIGAQFIGMGLLGEYIGRIYN DVRARPRYFVQQVIYPESTPFTEESHQ Protein Names:Recommended name: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase EC= 2.7.8.30 Alternative name(s): Undecaprenyl-phosphate Ara4FN transferase Short name= Ara4FN transferase Gene Names:Name:arnC Ordered Locus Names:SeD_A2642 Expression Region:1-327 Sequence Info:fµLl length protein

1.680,00 € 1680.0 EUR 1.680,00 € Hors taxes

1.680,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF477410SWN
URL de site web: /shop/csb-cf477410swn-elisa-recombinant-salmonella-dublin-undecaprenyl-phosphate-4-deoxy-4-formamido-l-arabinose-transferase-arnc-155403

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.