ELISA Recombinant Yersinia pestis bv. Antiqua Protein psiE homolog(psiE)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yersinia pestis bv. Antiqua (strain Angola) Uniprot NO.:A9R535 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAKNSRSQWIAKNLQRLLNVGLImLAAILVVFLVKETIHLGKVLFLSNQETSSYmLIEGI VIYFLYFEFIALIVKYFESGYHFPLRYFIYIGITAIIRLIIVDHENPIDTLIYSGSILVL VVTLYLANTERLKRE Protein Names:Recommended name: Protein psiE homolog Gene Names:Name:psiE Ordered Locus Names:YpAngola_A3917 Expression Region:1-135 Sequence Info:fµLl length protein