ELISA Recombinant Mouse Selection and upkeep of intraepithelial T-cells protein 10(Skint10)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Mus muscµLus (Mouse) Uniprot NO.:A7TZG1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:LDIQINIQVPDTEGVLLECTSGSLIPPAEMTWRDSKGNIIPHSTTFDSQDRAGLLYLKSS ILLKNRVQSPITCSIYNVTTNREKKRSVVLPDILFKSEYMSLMSNKFSCPLTYLFIIIFL NCLKGmLDFCCLKGKPVYFRELINKIKEVLNIKMRACCTLIWEFLLIVLYIAFLPFYLKF RSRASILDDAYPLHSNWLWDICIVLSVLMIFFTGLSLFLLWTLNCYGQMSYLPSMSMDLS KHDFEQNSSKSSEFQENYDVSCEIFLGTFEETIFSQHQESCIEDSFNPLQPLRLDCSLNW KT Protein Names:Recommended name: Selection and upkeep of intraepithelial T-cells protein 10 Short name= Skint-10 Gene Names:Name:Skint10 Expression Region:29-330 Sequence Info:fµLl length protein