ELISA Recombinant Methanococcus vannielii Cobalt transport protein CbiN(cbiN)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) Uniprot NO.:A6UQC5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MELKHVLMIIGIIILTIAPLVMYSGLTEEDGYFGGADGAASDLIMELSPEYEPWFEPFWE PPSGEIESLLFALQAAIGAIIIGYFFGYNKAKYDFESKN Protein Names:Recommended name: Cobalt transport protein CbiN Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiN Short name= ECF transporter S component CbiN Gene Names:Name:cbiN Ordered Locus Names:Mevan_0791 Expression Region:1-99 Sequence Info:fµLl length protein