Se rendre au contenu

ELISA Recombinant Haemophilus influenzae UPF0761 membrane protein CGSHiGG_04180 (CGSHiGG_04180)

https://assay.labm.com/web/image/product.template/128507/image_1920?unique=45d657d
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Haemophilus influenzae (strain PittGG) Uniprot NO.:A5µg94 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MISLKNFGLLFWKRFSENKLNQVAGALTYSTmLAMVPLVMVIFSIFSAFPVFNEVTGELK EMIFTNFAPSASDMVGEYIDQFVSNSKKMSAVGIVSLIAVALmLINNIDRTLNSIWHNSQ SRSPLSSFAIYWMILTLGPLIIGVSIGISSYIKIMFEQSEHLSLGLKLLSFVPFLFTWFI FTLIYTVVPNKKVKIKHSAYGAFLAAIFFTLGKQAFTWYIVTFPSYQLIYGAMATLPImL LWIQISWLVVLVGAQLASTLDEIGEQIEQ Protein Names:Recommended name: UPF0761 membrane protein CGSHiGG_04180 Gene Names:Ordered Locus Names:CGSHiGG_04180 Expression Region:1-269 Sequence Info:fµLl length protein

1.619,00 € 1619.0 EUR 1.619,00 € Hors taxes

1.619,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF403522HSE
URL de site web: /shop/csb-cf403522hse-elisa-recombinant-haemophilus-influenzae-upf0761-membrane-protein-cgshigg-04180-cgshigg-04180-128507

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.