Se rendre au contenu

ELISA Recombinant Danio rerio Phosphatidylinositide phosphatase SAC1-B(sacm1lb)

https://assay.labm.com/web/image/product.template/123518/image_1920?unique=c41145e
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Danio rerio (Zebrafish) (Brachydanio rerio) Uniprot NO.:A4VCH0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MANAYERFNLHSTPEKFYIEACDDGADDVLVIDRVSTEMTLAGIKDIPPSGITRPICGVM GTVRLVAGMYLIVITRKRKVGDLFGHTVWKAVEFDVISYKKTILHLTDIQMQDNKTFLTM INNVLNTDGFYFCTDYDLTHTQQRLSNTSPDFQEMSLLERADQRFMWNGNLLREIIAQPE LHKFAFPVIHGFIVMKPCCINGKVFEWIIISRRSCFRAGVRYYVRGIDSEGHAANFVETE QIVQFNNARASFVQTRGSIPFFWSQRPNLKYKPKPLISKDTNHMDGLRRHFESQVLIYGK QVILNLVNQKGSELPLEQAFAKMVSSMENGFIKYIAFDFHKECSKMRWHRLQILVDAVSD MQEEFGYFMVSSDGKVLSEQSGTFRSNCMDCLDRTNVIQSLLARRSLQSQLQRMGVLHVG QKIEEQADFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTHWGLVMDGWNSMIRY YKNNFSDGFRQDSIDLFLGNYSVDETDSLTPLHVKKDWKFLLLPVIMVVAFSMCIICLLM AGDTWTETLAYVLFWGMASALTAAVIVVNGREFVDAPKLVQKEKMD Protein Names:Recommended name: Phosphatidylinositide phosphatase SAC1-B EC= 3.1.3.- Alternative name(s): Suppressor of actin mutations 1-like protein B Gene Names:Name:sacm1lb ORF Names:si:ch211-222e23.8 Expression Region:1-586 Sequence Info:fµLl length protein

1.954,00 € 1954.0 EUR 1.954,00 € Hors taxes

1.954,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF395207DIL
URL de site web: /shop/csb-cf395207dil-elisa-recombinant-danio-rerio-phosphatidylinositide-phosphatase-sac1-b-sacm1lb-123518

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.