Se rendre au contenu

ELISA Recombinant Olimarabidopsis pumila NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic

https://assay.labm.com/web/image/product.template/148175/image_1920?unique=90f0e4f
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Olimarabidopsis pumila (Dwarf rocket) (Arabidopsis griffithiana) Uniprot NO.:A4QJY4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MILEHVLVLSAYLFLIGLYGLIMSRNMVRALMCLELILNAVNMNFVTFSDFFDNSQLKGD IFCIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSTLLNK Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 4L NADH-plastoquinone oxidoreductase subunit 4L Gene Names:Name:ndhE Expression Region:1-101 Sequence Info:fµLl length protein

1.442,00 € 1442.0 EUR 1.442,00 € Hors taxes

1.442,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF390543ODI
URL de site web: /shop/csb-cf390543odi-elisa-recombinant-olimarabidopsis-pumila-nad-p-h-quinone-oxidoreductase-subunit-4l-chloroplastic-148175

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.