ELISA Recombinant Danio rerio Neurexin-3a-beta(nrxn3a)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Danio rerio (Zebrafish) (Brachydanio rerio) Uniprot NO.:A1XQY0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:KPQPDIVLLPLPTSYEVDNTKMKSPLITSPMFRNVPTAIPTEPGIRRVPGASEVVRESSS TTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDETRNYITNSAQSNGAVMKDKQQS TKSGNKKQKNKDKEYYV Protein Names:Recommended name: Neurexin-3a-beta Alternative name(s): Neurexin IIIb-beta Cleaved into the following 2 chains: 1. Neurexin-3a-beta, soluble form 2. Neurexin-3a-beta, C-terminal fragment Short name= 3. NRXN3-CTF Gene Names:Name:nrxn3a Expression Region:536-672 Sequence Info:fµLl length protein