Se rendre au contenu

ELISA Recombinant Bacillus subtilis Lipoteichoic acid synthase-like yqgS(yqgS)

https://assay.labm.com/web/image/product.template/118396/image_1920?unique=5f2a55b
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bacillus subtilis (strain 168) Uniprot NO.:P54496 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:DSNSLTEIENYVTANAKDANKRLFGAAKGRNVILVSLESTQSFVINEKLNGEEITPFLND FIKQSYNFNNVYHQTGQGKTSDSEFIVDNSLYPLGRGAVFFTNAGNQYMAAPEILKNSGY YSAVLHANNKSFWNRDLMYDSFGYDSFFDINSYDVTDENSVGWGLKDKEFFEQSSELMKN LPQPFYSRLITLTNHFPFDLDEEDQLIDEYDSNSQTLNKYFPTVRYQDEALKRFIEKLKE DGLYDNSVIVLYGDHYGISENHNEAMGQFLGKEITPFEEVQLQKVPLVIHIPGITDKKPQ TIETVGGQIDIRPTLMNLLGIDTKDQIQFGNDLLSDEKLDFTVLRDGSFITDQVVYTDGA CYDKETGKPLEETKQCEAFADKAKQELSLSDEIIYGDLLRFYDQKRLDNSSKRKEKQmLD QAS Protein Names:Recommended name: Lipoteichoic acid synthase-like yqgS Cleaved into the following 2 chains: 1. Uncharacterized protein yqgS 2. Processed uncharacterized protein yqgS Gene Names:Name:yqgS Ordered Locus Names:BSU24840 Expression Region:216-638 Sequence Info:fµLl length protein

1.781,00 € 1781.0 EUR 1.781,00 € Hors taxes

1.781,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.

Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF346176BRJ
URL de site web: /shop/csb-cf346176brj-elisa-recombinant-bacillus-subtilis-lipoteichoic-acid-synthase-like-yqgs-yqgs-118396

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.