ELISA Recombinant Kluyveromyces lactis ADP,ATP carrier protein(AAC)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) Uniprot NO.:P49382 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTDKKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVEC FKRTAADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLAS GGLAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGF LPSVVGIVVYRGLYFGLYDSLKPLLLTGSLENSFLASFLLGWAVTTGASTASYPLDTVRR RMMMTSGQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVISMYDQLQVILF GKTFK Protein Names:Recommended name: ADP,ATP carrier protein Alternative name(s): ADP/ATP translocase Adenine nucleotide translocator Short name= ANT Gene Names:Name:AAC Ordered Locus Names:KLLA0E12353g Expression Region:1-305 Sequence Info:fµLl length protein