ELISA Recombinant Variola virus Hemagglutinin(HA)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Variola virus (isolate /India/Ind3/1967) (VARV) (Smallpox virus)
Uniprot NO.:P33807
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TPYPQTQISKKIGDDATLSCSRNNINDYVVMSAWYKEPNSIILLAAKSDVLYFDNYTKDK ISYDSPYDDLVTTITIKSLTAKDAGTYVCAFFMTSTTNDTDKVDYEEYSTELIVNTDSES TIDIILSGSSHSPETSSEKPDYINNFNCSLVFEIATPGPITDNVENHTDTVTYTSDIINT VSTSSRESTTVKTSGPITNKEDHTVTDTVSYTTVSTSSEIVTTKSTANDAHNDNEPSTVS PTTVKNITKSIGKYSTKDYVKVFGIAALIILSAVAIFCITYYICNKRSRKYKTENKV
Protein Names:Recommended name: Hemagglutinin
Gene Names:Name:HA ORF Names:A56R, J9R
Expression Region:17-313
Sequence Info:fµLl length protein
Référence interne:
CSB-CF329299VAR
URL de site web:
/shop/csb-cf329299var-elisa-recombinant-variola-virus-hemagglutinin-ha-160556
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.