ELISA Recombinant Malus domestica Chlorophyll a-b binding protein AB10, chloroplastic

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Malus domestica (Apple) (Pyrus malus) Uniprot NO.:P15773 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLKHAAKSKVSSSTCDRRVKYLGPFSGEWPSYLTGEFPGDYGWDTAGLSAYPETFAKNRE LEVIHSRCAMSAALGCIFPELLSVMGQGFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQS ILAIWTTKVILMGAVEGYRIARGPLGEVTDPLYPGSFDSLGLAEDTEAFAELKVKELKNG RLAMFSMFGFFVQAIVSRKDRLENLADHLGWTVNNNALSNVTNFVPGN Protein Names:Recommended name: Chlorophyll a-b binding protein AB10, chloroplastic Alternative name(s): LHCII type I CAB-AB10 Short name= LHCP Gene Names: Expression Region:41-268 Sequence Info:fµLl length protein