ELISA Recombinant General secretion pathway protein B(pulB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Klebsiella pneumoniae Uniprot NO.:P20725 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLVRPQEPYPQSEPPAAVGRMVQIPYVTVPLYAALLIALGWFGGEQWRNKPEPQPMRQSV AHAALVPLNQPAVKAAVAPVNAGPEIQAEPEIAIDEDNLPPLRYSAHVYASLADKRSIVL NGQSWKEGDSPLANLVIEHIQQDLTVFSFNGKTFTLAALDDWPGGAIEESPQAE Protein Names:Recommended name: General secretion pathway protein B Alternative name(s): PµLlµLanase operon protein PµLB Gene Names:Name:pµLB Expression Region:1-174 Sequence Info:fµLl length protein