Se rendre au contenu

ELISA Recombinant Cryptococcus neoformans var. neoformans serotype D Chitin synthase export chaperone(CHS7)

https://assay.labm.com/web/image/product.template/123081/image_1920?unique=c41145e
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans) Uniprot NO.:P0CM72 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSDNAAFKFGSFDYICEHAALVVCPmLGDQQGMAPTCYSRNVQLGSQIIFQPATCILHIA ALVMATImLLHVRSKYTAVGRKEIVLFFYMYIWVELFAIFLDSAIIPTANKVYPWFAAIY AGSVGALYWCLLLNGFVGFQFHEDGTPMSLWFLRISSLVVGAVCFGIPVATFKGTSSSMS PTNTVGLFITYLVFPCVCVLIYFISQmLLVVRTLDDRWVIGDLLFMAGFYIAGVLLLVTF SVTICDAVKHYVDGVFFSTLAFLFAVMMVYKYWDSITKEDLEFSVGSKQAVWDVKDPLLA TGMEYYEDDAQSAYRGAGGSLVGGYNGNQYYGNQPGYAQSAYGQQGYGQYGAGGGYGQGH Y Protein Names:Recommended name: Chitin synthase export chaperone Gene Names:Name:CHS7 Ordered Locus Names:CNK00300 Expression Region:1-361 Sequence Info:fµLl length protein

1.716,00 € 1716.0 EUR 1.716,00 € Hors taxes

1.716,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF316121CTL
URL de site web: /shop/csb-cf316121ctl-elisa-recombinant-cryptococcus-neoformans-var-neoformans-serotype-d-chitin-synthase-export-chaperone-chs7-123081

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.