Se rendre au contenu

ELISA Recombinant Haemophilus influenzae Phosphate regulon sensor protein phoR(phoR)

https://assay.labm.com/web/image/product.template/128348/image_1920?unique=4552294
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) Uniprot NO.:P71380 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKKILNFIVEINLAIIISLFTSDFILWFAIILLLILAWHHINEYRLLKYLNLKQDNKFSL LQLGTFSQTEAYHRHQIYKEKCASLRLLSQINKNIKYLPDAIIICQHNGNISWCNSIAPQ MFDFCWDKKVQENIFDVIFYEQFKHYFFSPKKRRPLVLLTYNQRYIEVQSHAYNSHMILV IARDITDMIHLLNSRQKFLSNINHELRTPLTVLQGYLEILADNNIQNPLQKKAIXAMQEQ SQRMEHLLQQFNFLAKIETTSDKDFRKFDMSAMINSLRKDTDILNTYNHHIEFIIQPNII IFGNESQLRSAVSNLIYNAIKHSGKQCHIQIQWETCEQGIKFNVIDNGVGISPQHIPHLT ERFYRVDESRSHLTGGSGLGLAIVKHTLLQYHSHLNIESTETKGSSFSFIIPKRFVISKN NKEIQ Protein Names:Recommended name: Phosphate regµLon sensor protein phoR EC= 2.7.13.3 Gene Names:Name:phoR Ordered Locus Names:HI_1378 Expression Region:1-425 Sequence Info:fµLl length protein

1.784,00 € 1784.0 EUR 1.784,00 € Hors taxes

1.784,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF304926HTA
URL de site web: /shop/csb-cf304926hta-elisa-recombinant-haemophilus-influenzae-phosphate-regulon-sensor-protein-phor-phor-128348

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.